Xenopus H3 K9me2 C110A (dimethylated K9)

Histone H3 Kc9me2 C110A, Recombinant Xenopus laevis - 4.5 mg

SKU: XH3_K9me2
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$359.00

Description:

  • Number of amino acids: 135, Molecular weight: 15284.75
  • Histone was treated under conditions to install analog of dimethyl Lys9 ** 

** Followed protocol from Simon MD et al.  The Site-Specific Installation of Methyl-Lysine Analogs into Recombinant Histones. 2007. Cell 128(5): 1003-1012. 

ARTKQTARK(me2)STGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD LRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA

  • Compared to the Pubmed H3 sequence (Accession # CAA51455), the Luger lab construct (Accession # CAD89679) contains the mutations: G102A and G111A.