Xenopus H3 K27me C110A (methylated K27)
Histone H3 Kc27me C110A, Recombinant Xenopus laevis - 4.5 mg
Fields with asterisk are required.
Description:
- Number of amino acids: 135, Molecular weight: 15270.75
- Histone was treated under conditions to install analog of methyl Lys27 **
** Followed protocol from Simon MD et al. The Site-Specific Installation of Methyl-Lysine Analogs into Recombinant Histones. 2007. Cell 128(5): 1003-1012.
ARTKQTARKSTGGKAPRKQLATKAARKmeSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD LRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
- Compared to the Pubmed H3 sequence (Accession # CAA51455), the Luger lab construct (Accession # CAD89679) contains the mutations: G102A and G111A.