Xenopus H3 K23C C110A

Histone H3 K23C C110A, Recombinant Xenopus laevis - 4.5 mg

SKU: XH3_K23C_C110A
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00

Description:

  • Number of amino acids: 135, Molecular weight: 15213.76, Theoretical pI: 11.26, Extinction coefficient: 4470 * 
  • Amino acid sequence: mutation at amino acid position 23 from lysine (K) to cysteine (C) and position 110 from cysteine (C) to alanine (A) 

    ARTKQTARKSTGGKAPRKQLATCAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA

  • Compared to the Pubmed H3 sequence (Accession # CAA51455), the Luger lab construct (Accession # CAD89679) contains the mutations: G102A and G111A.

 * Calculated by ExP-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam