Xenopus H3 - globular or tailless (a.a. 27-135)

Histone H3 tailless (a.a. 27-135), Recombinant Xenopus laevis - 4.0 mg

SKU: XH3_TL27
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00
Picture of Xenopus H3 - globular or tailless (a.a. 27-135)

Description:

  • Number of amino acids: 110 (with 1st methionine), Molecular weight: 12653.88, Theoretical pI: 10.38, Extinction coefficient: 4470 *
  • Amino acid sequence:

    MKCAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

  • Note: Compared to the Pubmed H3 sequence (Accession # CAA51455), the Luger lab construct (Accession # CAD89679) contains the mutations: G102A and G111A. This construct also appears to have the mutation S28C.

     * Calculated by ExPASy-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam