Xenopus H3 C110E L126A I130A

Histone H3 C110E L126A I130A, Recombinant Xenopus laevis - 4.5 mg

SKU: XH3_C110E _L126A_I130A
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00
Picture of Xenopus H3 C110E L126A I130A

Description:

  • Number of amino acids: 135, Molecular weight: 15212.68, Theoretical pI: 11.27, Extinction coefficient: 4470 * 
  • Amino acid sequence: mutation at amino acid position 110 from cysteine (C) to glutamic acid (E), position 126 from leucine (L) to alanine (A) and position 130 from Isoleucine (I) to alanine (A). 
    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD
    LRFQSSAVMALQEASEAYLVALFEDTNLEAIHAKRVTIMPKDIQAARRARGERA
  • Compared to the Pubmed H3 sequence (Accession # CAA51455), the Luger lab construct (Accession # CAD89679) contains the mutations: G102A and G111A.

 * Calculated by ExP-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam