Xenopus H2B - globular or tailless

Globular histone H2B, Recombinant Xenopus laevis - 4.0 mg

SKU: XH2B_GLOB
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00
Picture of Xenopus H2B - globular or tailless

Description:

  • Number of amino acids: 99, Molecular weight: 11156.9, Theoretical pI: 10.25, Extinction coefficient: 7450 *
  • Amino acid sequence:
    KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

  • Compared to the Pubmed Xenopus H2B sequence (Accession # CAA50513), the Luger lab construct (Accession # CAD89678) has the mutations: S22T, and G98V

     * Calculated by ExPASy-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam