Xenopus H2A a.a.1-112

Histone H2A a.a.1-112, Recombinant Xenopus laevis - 4.0 mg

SKU: XH2A_N112
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00
Picture of Xenopus H2A a.a.1-112

Description:

  • Number of amino acids: 112, Molecular weight: 12150.0, Theoretical pI: 11.17, Extinction coefficient: 4470 *
  • Amino acid sequence: C-terminal  a.a.113-129 deletion
    SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELA GNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQ

  • Compared to the Pubmed Xen H2A sequence (Accession # AAA49769), the Luger lab construct (Accession # CAD89676) contains the mutation G99R

     * Calculated by ExPASy-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam