Human H4 - globular or tailless (a.a. 20-102)

Histone H3 tailless (a.a. 38-135), Recombinant human - 3.2 mg

SKU: HH4_TL
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00
Picture of Human H4 - globular or tailless (a.a. 20-102)

Description:

  • Number of amino acids: 98, Molecular weight: 9521.21, Theoretical pI: 10.77, Extinction coefficient: 4470 *
  • Amino acid sequence:

    MKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

  • Note: Compared to the Pubmed H3 sequence (Accession # CAA51455), the Luger lab construct (Accession # CAD89679) contains the mutations: G102A and G111A.

     * Calculated by ExPASy-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam