Human H3 K27C C96S C110A

Histone H3 K27C C96S C110A, Recombinant human - 4.5 mg

SKU: HH3_K27C_C96SC110A
Fields with asterisk are required.
By clicking the checkbox below, you agree to not resell or misuse it. *
$198.00
Picture of Human H3 K27C C96S C110A

Description:

  • Number of amino acids: 135, Molecular weight: 15199.74, Theoretical pI: 11.26, Extinction coefficient: 4470 * 
  • Amino acid sequence: mutation at amino acid position 27 from lysine to cysteine (C), position 96 from cysteine (S) to serine (S) and position 110 from cysteine (C) to alanine (A)

    ARTKQTARKSTGGKAPRKQLATKAARCSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRG ERA

     * Calculated by ExPASy-ProtParam: https://web.expasy.org/cgi-bin/protparam/protparam